PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00149
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 298aa    MW: 32413.3 Da    PI: 9.6248
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00149genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59.5e-16228270547
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                 +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+ 
  AA61G00149 228 RRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRR 270
                 79***************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.4E-14221271No hitNo description
SMARTSM003381.3E-12224296IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427226271IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-10228273No hitNo description
CDDcd147071.63E-22228282No hitNo description
PfamPF001701.2E-12228271IPR004827Basic-leucine zipper domain
PROSITE patternPS000360231246IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDSQRGSLED PKSQSLNRQG SLYSLTLDEV QNHLGNSGKA LGSMNLDELL KSVCSVETNQ  60
PSSMAANGAA GAQDGLSRQG SLTLPRDLSK KTVDEVWKDI QQNKNEVNPH ERRDKQATLG  120
EMTLEDLLLK AGVVTETIPG SDHGLGSGGG GGGGSGAGLG QNISQAGPWV QYHQLPSMPQ  180
SQAFMAYPVS DMQAMVSQSS LMGGLSDTQT PGRKRVASGE VVEKTVERRQ KRMIKNRESA  240
ARSRARKQAY THELEIKVSR LEEENERLRR QKEVEKILPS APPPDPKRQL RRTSSAPF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402943.10.0hypothetical protein EUTSA_v10006121mg
SwissprotQ9LES30.0AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4NE970.0V4NE97_EUTSA; Uncharacterized protein
STRINGAT3G56850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-178ABA-responsive element binding protein 3